PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 288aa    MW: 31804.6 Da    PI: 9.478
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600090.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK64.32e-202673350
          RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                    k+is++++sk F+lp+ dAA +Lgvc++vLK+iC ++G+ RWP+Rk+ 
  XP_009600090.1 26 KSISFDQVSKLFNLPLSDAAESLGVCASVLKKICYENGLVRWPYRKVI 73
                    79********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.4261094IPR003035RWP-RK domain
PfamPF020423.2E-182872IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSNLQGSGPI SNPIQNPTPN PSTDPKSISF DQVSKLFNLP LSDAAESLGV CASVLKKICY  60
ENGLVRWPYR KVISGKCIED IKEEASREKQ ERSVEFPKAA GEKRDSLASS AISSFPGSPL  120
QNKSISSTME MPKAGAFSQQ QGTRNAQSGS LPHFRISNLT KATSVSYDEF KYGFPSDGLS  180
TVTYRWWGNK SPDNNEDSQP NNDNAKNSKE QAENVAEKSE CKTSVDSMEV SSLTDVRKRA  240
VKEGKEMLRL GVYRGHRANM LDSTKRKILR QVFKSYFHVN GGMSNLES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600090.10.0PREDICTED: uncharacterized protein LOC104095632
TrEMBLA0A0V0HW321e-160A0A0V0HW32_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000202961e-158(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA107441921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-11RWP-RK domain-containing protein